Web Analytics
518-831-8000 sales@utechproducts.com

Selm, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Selm, Each

$ 1,757.70

Details

This gene encodes a selenoprotein, which contains a selenocysteine (sec) residue at its active site. The selenocysteine is encoded by the uga codon that normally signals translation termination. The 3' utr of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (secis), that is necessary for the recognition of uga as a sec codon rather than as a stop signal. This gene is expressed in a variety of tissues, and the protein is localized to the perinuclear structures. [Provided by refseqsequence: qdipfyhnlvmkhlpgadpelvllgrryeeleriplsemtreeinalvqelgfyrkaapdaqvppeyvwapakppeetsdha

Additional Information

SKU 10291701
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27474