Web Analytics
518-831-8000 sales@utechproducts.com

SELM, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SELM, Each

1,757.70

Details:

This gene encodes a selenoprotein, which contains a selenocysteine (Sec) residue at its active site. The selenocysteine is encoded by the UGA codon that normally signals translation termination. The 3' UTR of selenoprotein genes have a common stem-loop structure, the sec insertion sequence (SECIS), that is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. This gene is expressed in a variety of tissues, and the protein is localized to the perinuclear structures. [provided by RefSeqSequence: QDIPFYHNLVMKHLPGADPELVLLGRRYEELERIPLSEMTREEINALVQELGFYRKAAPDAQVPPEYVWAPAKPPEETSDHA

Additional Information

SKU 10291701
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27474