Web Analytics
518-831-8000 sales@utechproducts.com

Sema3f, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sema3f, Each

$ 1,318.98

Details

The semaphorins are a family of proteins that are involved in signaling. All the family members have a secretion signal, a 500-amino acid sema domain, and 16 conserved cysteine residues (kolodkin et al., 1993 [Pubmed 8269517]). Sequence comparisons have grouped the secreted semaphorins into 3 general classes, all of which also have an immunoglobulin domain. The semaphorin iii family, consisting of human semaphorin iii (sema3a; mim 603961), chicken collapsin, and mouse semaphorins a, d, and e, all have a basic domain at the c terminus. Chicken collapsin contributes to path finding by axons during development by inhibiting extension of growth cones (luo et al., 1993 [Pubmed 8402908]) through an interaction with a collapsin response mediator protein of relative molecular mass 62k (crmp62) (goshima et al., 1995 [Pubmed 7637782]), a putative homolog of an axonal guidance associated unc33 gene product (mim 601168). Sema3f is a secreted member of the semaphorin iii family.[Supplied by omimsequence: tppyqelaqllaqpevglihqycqgywrhvppspreapgaprspepqdqkkprnrrhhppdt

Additional Information

SKU 10288689
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22649