Web Analytics
518-831-8000 sales@utechproducts.com

Sh3tc2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sh3tc2, Each

1,757.70

Details

This gene encodes a protein with two n-terminal src homology 3 (sh3) domains and 10 tetratricopeptide repeat (tpr) motifs, and is a member of a small gene family. The gene product has been proposed to be an adapter or docking molecule. Mutations in this gene result in autosomal recessive charcot-marie-tooth disease type 4c, a childhood-onset neurodegenerative disease characterized by demyelination of motor and sensory neurons. [Provided by refseqsequence: svlsflydkkylphlavasvqqhgiqsaqgmslpiwqvhlvlqnttkllgfpspgwgevsalacpmlrqalaaceeladrstqralclilskvylehrspdgaihylsq

Additional Information

SKU 10289109
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23149