Shroom4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Shroom4, Each

Details:

This gene encodes a member of the apx/shroom family, which contain an n-terminal pdz domain and a c-terminal asd2 motif. The encoded protein may play a role in cytoskeletal architecture. Mutations in this gene have been linked to stocco dos santos x-linked mental retardation syndrome. Alternatively spliced transcript variants have been described. [Provided by refseqsequence: gscalnpeevleqpqplsfghlegsrqgsqsvpaeqesfalhssdflppirghlgsqpeqaqppcyygigglwrtsgqeatesakqefqhfsppsgapgiptsysayynisvakaellnklkdqpemaeig