Web Analytics
518-831-8000 sales@utechproducts.com

SIGMAR1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SIGMAR1, Each

1,757.70

Details:

This gene encodes a receptor protein that interacts with a variety of psychotomimetic drugs, including cocaine and amphetamines. The receptor is believed to play an important role in the cellular functions of various tissues associated with the endocrine, immune, and nervous systems. As indicated by its previous name, opioid receptor sigma 1 (OPRS1), the product of this gene was erroneously thought to function as an opioid receptor; it is now thought to be a nonopioid receptor. Alternative splicing of this gene results in transcript variants encoding distinct isoforms. [provided by RefSeqSequence: HSGRYWAEISDTIISGTFHQWREGTTKSEVFYPGETVVHGPGEATAVEWGPNTWMVEYGRGVIPSTLAFALADTVFSTQDFLTLFYTLRSYARGLRLELTTY

Additional Information

SKU 10287822
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21642