Skap1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Skap1, Each

Details:

This gene encodes a t cell adaptor protein, a class of intracellular molecules with modular domains capable of recruiting additional proteins but that exhibit no intrinsic enzymatic activity. The encoded protein contains a unique n-terminal region followed by a ph domain and c-terminal sh3 domain. Along with the adhesion and degranulation-promoting adaptor protein, the encoded protein plays a critical role in inside-out signaling by coupling t-cell antigen receptor stimulation to the activation of integrins. [Provided by refseqsequence: sltipyeedeeeeekeetyddidgfdspscgsqcrptilpgsvgikepteekeeediyevlpdeehdleedesgtrrkgvdyasyyqglwdchgdqpdelsfqrgdl