Web Analytics
518-831-8000 sales@utechproducts.com

Slc10a3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc10a3, Each

$ 1,757.70

Details

This gene maps to a gc-rich region of the x chromosome and was identified by its proximity to a cpg island. It is thought to be a housekeeping gene. Alternative splicing results in multiple transcript variants encoding distinct isoformssequence: dsegiivissqypgqanrtapgpmlrvtsldtevltiknvsaitwgggggfvvsihsglaglaplhiqlvdaheapptlieerrdfcikvspaedtpatlsadlahfsenpilylllplifvnkcsfgckvelevlkglmq

Additional Information

SKU 10287638
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21440