Slc10a3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc10a3, Each
$ 1,757.70
|
|
Details:
This gene maps to a gc-rich region of the x chromosome and was identified by its proximity to a cpg island. It is thought to be a housekeeping gene. Alternative splicing results in multiple transcript variants encoding distinct isoformssequence: dsegiivissqypgqanrtapgpmlrvtsldtevltiknvsaitwgggggfvvsihsglaglaplhiqlvdaheapptlieerrdfcikvspaedtpatlsadlahfsenpilylllplifvnkcsfgckvelevlkglmq
Additional Information
| SKU | 10287638 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21440 |
