Slc19a1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc19a1, Each

Details:

Transport of folate compounds into mammalian cells can occur via receptor-mediated (see mim 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (mtx) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. Rfc1 plays a role in maintaining intracellular concentrations of folate.[Supplied by omimsequence: aqalsvqdkglgglqpaqspplspedslgavgpasleqrqsdpylaqapapqaaeflspvttpspctlcsaqasgpeaadetcpqlavhppgvsklglqclpsdgvqnv