Slc19a1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc19a1, Each
$ 1,757.70
|
|
Details:
Transport of folate compounds into mammalian cells can occur via receptor-mediated (see mim 136430) or carrier-mediated mechanisms. A functional coordination between these 2 mechanisms has been proposed to be the method of folate uptake in certain cell types. Methotrexate (mtx) is an antifolate chemotherapeutic agent that is actively transported by the carrier-mediated uptake system. Rfc1 plays a role in maintaining intracellular concentrations of folate.[Supplied by omimsequence: aqalsvqdkglgglqpaqspplspedslgavgpasleqrqsdpylaqapapqaaeflspvttpspctlcsaqasgpeaadetcpqlavhppgvsklglqclpsdgvqnv
Additional Information
| SKU | 10288101 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21962 |
