Web Analytics
518-831-8000 sales@utechproducts.com

SLC22A15, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC22A15, Each

1,757.70

Details:

Organic ion transporters, such as SLC22A15, transport various medically and physiologically important compounds, including pharmaceuticals, toxins, hormones, neurotransmitters, and cellular metabolites. These transporters are also referred to as amphiphilic solute facilitators (ASFs).[supplied by OMIMSequence: ESPRWLYSQGRLSEAEEALYLIAKRNRKLKCTFSLTHPANRSCRETGSFLDLFR

Additional Information

SKU 10287461
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21238