Web Analytics
518-831-8000 sales@utechproducts.com

SLC22A8 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC22A8, Each

1,757.70

Details:

The protein encoded by this gene is involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of the kidney. [provided by RefSeqSequence: KKEEGERLSLEELKLNLQKEISLAKAKYTASDLFRIPMLR

Additional Information

SKU 10292182
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28282