Slc24a6, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc24a6, Each
$ 1,757.70
|
|
Details:
Slc24a6 belongs to a family of potassium-dependent sodium/calcium exchangers that maintain cellular calcium homeostasis through the electrogenic countertransport of 4 sodium ions for 1 calcium ion and 1 potassium ion (cai and lytton, 2004 [pubmed 14625281]).[Supplied by omimsequence: rqrrgslfcpmpvtpeilsdseedrvssntnsydygdeyrplffyqettaqilvralnpldymkwrrksaywkal
Additional Information
| SKU | 10289575 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23680 |
