Web Analytics
518-831-8000 sales@utechproducts.com

SLC25A22, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC25A22, Each

1,757.70

Details:

The SLC25 gene family encodes mitochondrial carriers that transport a variety of metabolites across the inner mitochondrial membrane (Palmieri, 2004 [PubMed 14598172]). SLC25A22, also known as GC1, is 1 of the 2 mitochondrial glutamate/H symporters, the other being SLC25A18 (MIM 609303).[supplied by OMIMSequence: RSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLLKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKILAAQGQLSAQGGAQPSVE

Additional Information

SKU 10288079
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21935