Web Analytics
518-831-8000 sales@utechproducts.com

SLC26A8 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC26A8, Each

1,757.70

Details:

This gene is one member of a family of sulfate/anion transporter genes. Family members are well conserved in their genomic (number and size of exons) and protein (aa length among species) structures yet have markedly different tissue expression patterns. This gene is expressed primarily in spermatocytes. Two transcript variants encoding different isoforms have been found. [provided by RefSeqSequence: ELEPEMEPKAETETKTQTEMEPQPETEPEMEPNPKSRPRAHTFPQQRYWPMYHPSMASTQSQTQTRTWSVERRRHPMDSYSPEGNSNEDV

Additional Information

SKU 10289167
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23216