Web Analytics
518-831-8000 sales@utechproducts.com

SLC35B2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC35B2, Each

1,757.70

Details:

Sulfotransferases (e.g., SULT4A1; MIM 608359) use an activated form of sulfate, 3-prime-phosphoadenosine 5-prime-phosphosulfate (PAPS), as a common sulfate donor for sulfation of glycoproteins, proteoglycans, and glycolipids in the endoplasmic reticulum and Golgi apparatus. SLC35B2 is located in the microsomal membrane and transports PAPS from the cytosol, where it is synthesized, into the Golgi lumen (Kamiyama et al., 2003 [PubMed 12716889]).[supplied by OMIMSequence: FRRKNYLETGRGLCFPLVKACVFGNEPKASDEVPLAPRTEAAETT

Additional Information

SKU 10288401
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22320