Web Analytics
518-831-8000 sales@utechproducts.com

SLC36A1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC36A1, Each

1,757.70

Details:

This gene encodes a member of the eukaryote-specific amino acid/auxin permease (AAAP) 1 transporter family. The encoded protein functions as a proton-dependent, small amino acid transporter. This gene is clustered with related family members on chromosome 5q33.1. [provided by RefSeqSequence: MSTQRLRNEDYHDYSSTDVSPEESPSEGLNNLSSPGSYQRFGQSNSTTWFQT

Additional Information

SKU 10288921
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22928