Web Analytics
518-831-8000 sales@utechproducts.com

Slc43a1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc43a1, Each

1,757.70

Details:

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIMSequence: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ

Additional Information

SKU 10287288
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21045