Web Analytics
518-831-8000 sales@utechproducts.com

SLC43A1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC43A1, Each

1,757.70

Details:

SLC43A1 belongs to the system L family of plasma membrane carrier proteins that transports large neutral amino acids (Babu et al., 2003 [PubMed 12930836]).[supplied by OMIMSequence: MDWRIKDCVDAPTQGTVLGDARDGVATKSIRPRYCKIQ

Additional Information

SKU 10287288
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21045