Web Analytics
518-831-8000 sales@utechproducts.com

SLC6A1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC6A1, Each

1,757.70

Details:

The SLC6A1 gene encodes a gamma-aminobutyric acid (GABA) transporter, which removes GABA from the synaptic cleft (Hirunsatit et al., 2009 [PubMed 19077666]).[supplied by OMIMSequence: IYYLYNSFTTTLPWKQCDNPWNTDRCFSNYSMVNTTNMTSAVVEFWERNMHQMTDGLDKPG

Additional Information

SKU 10286955
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20649