Slc6a7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc6a7, Each

Details:

This gene is a member of the gamma-aminobutyric acid (gaba) neurotransmitter gene family and encodes a high-affinity mammalian brain l-proline transporter protein. This transporter protein differs from other sodium-dependent plasma membrane carriers by its pharmacological specificity, kinetic properties, and ionic requirements. [Provided by refseqsequence: sltsdlpwehcgnwwntelclehrvskdgngalplnltctvspseeywsryvlhiqgsqgigspg