Web Analytics
518-831-8000 sales@utechproducts.com

SLC7A3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC7A3, Each

1,317.60

Details:

SLC7A3 is a member of the system y family of transporters characterized by sodium-independent transport of cationic amino acids.[supplied by OMIMSequence: RYQPDQETKTGEEVELQEEAITTESEKLTLWGLFFPLNSIPTPLSGQI

Additional Information

SKU 10286592
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20231