Web Analytics
518-831-8000 sales@utechproducts.com

SLC7A9 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC7A9, Each

1,814.40

Details:

This gene encodes a protein that belongs to a family of light subunits of amino acid transporters. This protein plays a role in the high-affinity and sodium-independent transport of cystine and neutral and dibasic amino acids, and appears to function in the reabsorption of cystine in the kidney tubule. Mutations in this gene cause non-type I cystinuria, a disease that leads to cystine stones in the urinary system due to impaired transport of cystine and dibasic amino acids. Two transcript variants, which encode the same protein, have been found for this gene. [provided by RefSeqSequence: YKFGWAQKISKPITMHLQMLMEVVPPEEDPE

Additional Information

SKU 10291969
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27931