Slc9a3r2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slc9a3r2, Each

Details:

Nhe3 (slc9a3; mim 182307) is a sodium/hydrogen exchanger in the brush border membrane of the proximal tubule, small intestine, and colon that plays a major role in transepithelial sodium absorption. Slc9a3r2, as well as slc9a3r1 (mim 604990) and protein kinase a phosphorylation, may play a role in nhe3 regulation.[Supplied by omimsequence: rlvevngvnvegethhqvvqrikavegqtrllvvdqetdeelrrrqltcteemaqrglppahdpwepkpdwahtgshsseagkkdvsgplrelrprlchlrkgpqgygfnlh