Web Analytics
518-831-8000 sales@utechproducts.com

SLC9A3R2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SLC9A3R2, Each

1,750.95

Details:

NHE3 (SLC9A3; MIM 182307) is a sodium/hydrogen exchanger in the brush border membrane of the proximal tubule, small intestine, and colon that plays a major role in transepithelial sodium absorption. SLC9A3R2, as well as SLC9A3R1 (MIM 604990) and protein kinase A phosphorylation, may play a role in NHE3 regulation.[supplied by OMIMSequence: RLVEVNGVNVEGETHHQVVQRIKAVEGQTRLLVVDQETDEELRRRQLTCTEEMAQRGLPPAHDPWEPKPDWAHTGSHSSEAGKKDVSGPLRELRPRLCHLRKGPQGYGFNLH

Additional Information

SKU 10286449
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20079