Web Analytics
518-831-8000 sales@utechproducts.com

Slirp Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Slirp, Each

1,757.70

Details

Steroid receptor rna activator (sra, or sra1; mim 603819) is a complex rna molecule containing multiple stable stem-loop structures that functions in coactivation of nuclear receptors. Slirp interacts with stem-loop structure-7 of sra (str7) and modulates nuclear receptor transactivation (hatchell et al., 2006 [Pubmed 16762838]).[Supplied by omimsequence: lrrsinqpvafvrripwtaassqlkehfaqfghvrrcilpfdketgfhrglgwvqfsseeglrnalqqenhiidgvkvqvhtrrpklpqtsdd

Additional Information

SKU 10287502
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21287