Web Analytics
518-831-8000 sales@utechproducts.com

Smcr7, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Smcr7, Each

$ 1,757.70

Details

This gene encodes a protein of unknown function. The gene is located within the smith-magenis syndrome region on chromosome 17. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms. [Provided by refseqsequence: ppaalsqpvlplapsssapegpaetdpevtpqlsspaplcltlqerllaferdrvtipaaqvalakqlagdialelqayfrskfpelpfgafvpggplydglqagaadhvrll

Additional Information

SKU 10289804
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23926