Web Analytics
518-831-8000 sales@utechproducts.com

SNRNP40 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SNRNP40, Each

1,757.70

Details:

This gene encodes a component of the U5 small nuclear ribonucleoprotein (snRNP) particle. The U5 snRNP is part of the spliceosome, a multiprotein complex that catalyzes the removal of introns from pre-messenger RNAs. [provided by RefSeqSequence: GDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPARRGPQLVCTGSDDGTVKLWDIRKKAAIQ

Additional Information

SKU 10288046
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21895