Snrpd3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Snrpd3, Each
$ 1,750.95
|
|
Details:
The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mrna splicing and small nuclear ribonucleoprotein biogenesis. [Provided by refseqsequence: kvlheaeghivtcetntgevyrgklieaednmncqmsnitvtyrdgrvaqleqvyirgskirflilpdmlknapmlksmknknqgsgagrgkaailkaqvaargrgrgmgrgni
Additional Information
| SKU | 10286411 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB20038 |
