Web Analytics
518-831-8000 sales@utechproducts.com

Snw1 Rabbit Anti-Human, Mouse, Rat, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Snw1, Each

1,757.70

Details:

This gene, a member of the snw gene family, encodes a coactivator that enhances transcription from some pol ii promoters. This coactivator can bind to the ligand-binding domain of the vitamin d receptor and to retinoid receptors to enhance vitamin d-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(a)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of ski oncoproteins that is required for transforming activity. [Provided by refseqsequence: rnlsraapdkrsklqrnenrdisevialgvpnprtsnevqydqrlfnqskgmdsgfaggedeiynvydqawrggkdmaqsiyrpsknldkdmygddleariktnrfvpdkefsgsdrrqrgregpvqfeedpfgldkf

Additional Information

SKU 10292505
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28666