Web Analytics
518-831-8000 sales@utechproducts.com

SNX18, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SNX18, Each

1,757.70

Details:

This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein does not contain a coiled coil region, like some family members, but contains a SH3 domain. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: DDEWDDSSTVADEPGALGSGAYPDLDGSSSAGVGAAGRYRLSTRSDLSLGSRGGSVPPQHHPSGPKSSATVSRNLN

Additional Information

SKU 10289125
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23168