SNX2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SNX2, Each
$ 1,757.70
|
|
Details:
This gene encodes a member of the sorting nexin family. Members of this family contain a phox (PX) domain, which is a phosphoinositide binding domain, and are involved in intracellular trafficking. This protein associates with formin-binding protein 17, but its function is unknown. This protein may form oligomeric complexes with family members. [provided by RefSeqSequence: ATEEVSLDSPEREPILSSEPSPAVTPVTPTTLIAPRIESKSMSAPVIFDRSREEIEEEANGDIFDIEIGVSDP
Additional Information
| SKU | 10289069 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23106 |
