Spag16, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Spag16, Each

Details:

Cilia and flagella are comprised of a microtubular backbone, the axoneme, which is organized by the basal body and surrounded by plasma membrane. Spag16 encodes 2 major proteins that associate with the axoneme of sperm tail and the nucleus of postmeiotic germ cells, respectively (zhang et al., 2007 [Pubmed 17699735]).[Supplied by omimsequence: nlkkdlkhykqaadkaredllkiqkerdfhrmhhkrivqeknklindlkglklhyasyeptirvlhekhhtllkekmltslerdkvvg