Web Analytics
518-831-8000 sales@utechproducts.com

SPG20, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SPG20, Each

1,757.70

Details:

This gene encodes a protein containing a MIT (Microtubule Interacting and Trafficking molecule) domain, and is implicated in regulating endosomal trafficking and mitochondria function. The protein localizes to mitochondria and partially co-localizes with microtubules. Stimulation with epidermal growth factor (EGF) results in protein translocation to the plasma membrane, and the protein functions in the degradation and intracellular trafficking of EGF receptor. Multiple alternatively spliced variants, encoding the same protein, have been identified. Mutations associated with this gene cause autosomal recessive spastic paraplegia 20 (Troyer syndrome). [provided by RefSeqSequence: AGAYMFPDTMLQAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQLKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSE

Additional Information

SKU 10289315
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23388