Web Analytics
518-831-8000 sales@utechproducts.com

Ssrp1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ssrp1, Each

1,757.70

Details

The protein encoded by this gene is a subunit of a heterodimer that, along with supt16h, forms chromatin transcriptional elongation factor fact. Fact interacts specifically with histones h2a/h2b to effect nucleosome disassembly and transcription elongation. Fact and cisplatin-damaged dna may be crucial to the anticancer mechanism of cisplatin. This encoded protein contains a high mobility group box which most likely constitutes the structure recognition element for cisplatin-modified dna. This protein also functions as a co-activator of the transcriptional activator p63. An alternatively spliced transcript variant of this gene has been described, but its full-length nature is not known. [Provided by refseqsequence: ddaevslmevrfyvpptqedgvdpveafaqnvlskadviqatgdaicifrelqcltprgrydiriyptflhlhgktfdykipyttvlrlfllphkdqrqmffvisldppikqgqtryhflillfskdedisltlnmneeeve

Additional Information

SKU 10286494
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20128