Web Analytics
518-831-8000 sales@utechproducts.com

STAP2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STAP2, Each

1,757.70

Details:

This gene encodes the substrate of breast tumor kinase, an Src-type nonreceptor tyrosine kinase. The encoded protein possesses domains and several tyrosine phosphorylation sites characteristic of adaptor proteins that mediate the interactions linking proteins involved in signal transduction pathways. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: QGLTIYFYNSNRDFQHVEKLNLGAFEKLTDEIPWGSSRDPGTHFSLILRNQEIKFKVETLECREMWKGFILTVVELRVPTDLTLLPGHLYMMSEVLAKEEARRALETPSCFLKVSRLEAQLLLE

Additional Information

SKU 10288050
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21900