Web Analytics
518-831-8000 sales@utechproducts.com

STARD13 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STARD13, Each

1,757.70

Details:

This gene encodes a protein that contains a sterile alpha motif domain in the N-terminus, an ATP/GTP-binding motif, a GTPase-activating protein domain, and a STAR-related lipid transfer domain in the C-terminus. The gene is located in a region of chromosome 13 that has loss of heterozygosity in hepatic cancer. At least three alternatively spliced transcript variants have been described for this gene. [provided by RefSeqSequence: NPVMLDAPLVSSSLPQPPRDVLNHPFHPKNEKPTRARAKSFLKRMETLRGKGAHGRHKGSGRTGGLVISGPMLQQEPESFKAMQCIQIPNGDLQNSPPPACRKGLPC

Additional Information

SKU 10291909
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27863