Stard13 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Stard13, Each

Details:

This gene encodes a protein that contains a sterile alpha motif domain in the n-terminus, an atp/gtp-binding motif, a gtpase-activating protein domain, and a star-related lipid transfer domain in the c-terminus. The gene is located in a region of chromosome 13 that has loss of heterozygosity in hepatic cancer. At least three alternatively spliced transcript variants have been described for this gene. [Provided by refseqsequence: npvmldaplvssslpqpprdvlnhpfhpknekptraraksflkrmetlrgkgahgrhkgsgrtgglvisgpmlqqepesfkamqciqipngdlqnspppacrkglpc