Web Analytics
518-831-8000 sales@utechproducts.com

STON2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STON2, Each

1,757.70

Details:

Endocytosis of cell surface proteins requires a dynamic complex of proteins that assemble on the inner surface of the plasma membrane. Stonin-2 is a component of the endocytic machinery that likely regulates vesicle endocytosis.[supplied by OMIMSequence: RTPSVTEAPPWRATNPFLNETLQDVQPSPINPFSAFFEEQERRSQNSSISSTTGKSQRDSLIVIYQDAISFDDSSKTQSHSDAVEKLKQLQIDDPDHFGSATLPDDDPVAWIELDAHPPGSARSQPRDGWPMMLRIPEK

Additional Information

SKU 10286526
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20161