Web Analytics
518-831-8000 sales@utechproducts.com

STOX1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STOX1, Each

1,757.70

Details:

The protein encoded by this gene may function as a DNA binding protein. Mutations in this gene are associated with pre-eclampsia/eclampsia 4 (PEE4). Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: SEFQPGSIRLEKHPKLPATQPIPRIKSPNEMVGQKPLGEITTVLGSHLIYKKRISNPFQGLSHRGSTISKGHKIQKTSDLKPSQTGPKEK

Additional Information

SKU 10289132
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23175