Web Analytics
518-831-8000 sales@utechproducts.com

STS, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STS, Each

1,757.70

Details:

The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause X-linked ichthyosis (XLI). [provided by RefSeqSequence: YEIIQQPMSYDNLTQRLTVEAAQFIQRNTETPFLLVLSYLHVHTALFSSKDFAGKSQHGVYGDAVEEMDWSVGQILNLLDELRLANDTLIYFTSDQGAHVEEVSSKGEIHGGSNGIY

Additional Information

SKU 10292449
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28606