Sts, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sts, Each
$ 1,757.70
|
|
Details:
The protein encoded by this gene catalyzes the conversion of sulfated steroid precursors to estrogens during pregnancy. The encoded protein is found in the endoplasmic reticulum, where it acts as a homodimer. Mutations in this gene are known to cause x-linked ichthyosis (xli). [Provided by refseqsequence: yeiiqqpmsydnltqrltveaaqfiqrntetpfllvlsylhvhtalfsskdfagksqhgvygdaveemdwsvgqilnlldelrlandtliyftsdqgahveevsskgeihggsngiy
Additional Information
| SKU | 10292449 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB28606 |
