Stt3b, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Stt3b, Each
$ 1,757.70
|
|
Details:
The simp protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, b6(dom1). Like itm1 (mim 601134), simp is homologous to yeast stt3, an oligosaccharyltransferase essential for cell proliferation (mcbride et al., 2002 [Pubmed 12439619]).[Supplied by omimsequence: nppvedssdeddkrnqgnlydkagkvrkhateqekteeglgp
Additional Information
| SKU | 10289018 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23044 |
