Web Analytics
518-831-8000 sales@utechproducts.com

STT3B, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant STT3B, Each

1,757.70

Details:

The SIMP protein contains a highly immunogenic minor histocompatibility antigen epitope of 9 amino acids, B6(dom1). Like ITM1 (MIM 601134), SIMP is homologous to yeast STT3, an oligosaccharyltransferase essential for cell proliferation (McBride et al., 2002 [PubMed 12439619]).[supplied by OMIMSequence: NPPVEDSSDEDDKRNQGNLYDKAGKVRKHATEQEKTEEGLGP

Additional Information

SKU 10289018
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23044