Sucla2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Sucla2, Each

Details:

Succinyl-coa synthetase (scs) is a mitochondrial matrix enzyme that acts as a heterodimer, being composed of an invariant alpha subunit and a substrate-specific beta subunit. The protein encoded by this gene is an atp-specific scs beta subunit that dimerizes with the scs alpha subunit to form scs-a, an essential component of the tricarboxylic acid cycle. Scs-a hydrolyzes atp to convert succinate to succinyl-coa. Defects in this gene are a cause of myopathic mitochondrial dna depletion syndrome. A pseudogene of this gene has been found on chromosome 6. [Provided by refseqsequence: fggimrcdviaqgivmavkdleikipvvvrlqgtrvddakaliadsglkilacddldeaarmvvklseivtlakqahvdvkfqlp