Web Analytics
518-831-8000 sales@utechproducts.com

SUMF1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SUMF1, Each

1,757.70

Details:

This gene encodes an enzyme that catalyzes the hydrolysis of sulfate esters by oxidizing a cysteine residue in the substrate sulfatase to an active site 3-oxoalanine residue, which is also known as C-alpha-formylglycine. Mutations in this gene cause multiple sulfatase deficiency, a lysosomal storage disorder. Alternative splicing results in multiple transcript variants. [provided by RefSeqSequence: MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR

Additional Information

SKU 10289159
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23205