Syf2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Syf2, Each

Details:

This gene encodes a nuclear protein that interacts with cyclin d-type binding-protein 1, which is thought to be a cell cycle regulator at the g1/s transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [Provided by refseqsequence: aaiaasevlvdsaeegslaaaaelaaqkreqrlrkfrelhlmrnearklnhqevveedkrlklpanweakkarlewelkeeekkkecaarg