Web Analytics
518-831-8000 sales@utechproducts.com

SYF2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant SYF2, Each

1,757.70

Details:

This gene encodes a nuclear protein that interacts with cyclin D-type binding-protein 1, which is thought to be a cell cycle regulator at the G1/S transition. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeqSequence: AAIAASEVLVDSAEEGSLAAAAELAAQKREQRLRKFRELHLMRNEARKLNHQEVVEEDKRLKLPANWEAKKARLEWELKEEEKKKECAARG

Additional Information

SKU 10292011
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28017