Syt12, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Syt12, Each

Details:

The srg1 gene encodes a protein that is a member of a family of proteins involved in the regulation of transmitter release in the nervous system (fernandez-chacon et al., 2001 [Pubmed 11242035]). The membrane-associated synaptic srg1 protein is under thyroid hormone control during brain development (thompson, 1996 [pubmed 8987811]).[Supplied by omimsequence: llslsylptaerltvvvvkaknliwtndkttadpfvkvyllqdgrkmskkktavkrddpnpvfneamifsvpaivlqdlslrvtvaesssdgrgdnvghviigpsasgmgtthwnqmlatlrrpvsmwhav