Web Analytics
518-831-8000 sales@utechproducts.com

TACC1 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TACC1, Each

1,757.70

Details:

This locus may represent a breast cancer candidate gene. It is located close to FGFR1 on a region of chromosome 8 that is amplified in some breast cancers. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: PTTTLTSSDFCSPTGNHVNEILESPKKAKSRLITSGCKVKKHETQSLALDACSRDEGAVISQISDISNRDGHATDEEKLASTSCGQKSAGAE

Additional Information

SKU 10287910
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21740