Web Analytics
518-831-8000 sales@utechproducts.com

TAF7L, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TAF7L, Each

1,757.70

Details:

This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. [provided by RefSeqSequence: ESQDEVPDEVENQFILRLPLEHACTVRNLARSQSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQMLVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRK

Additional Information

SKU 10292382
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28528