Web Analytics
518-831-8000 sales@utechproducts.com

THSD1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant THSD1, Each

1,757.70

Details:

The protein encoded by this gene contains a type 1 thrombospondin domain, which is found in a number of proteins involved in the complement pathway, as well as in extracellular matrix proteins. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeqSequence: VPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLTDTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQ

Additional Information

SKU 10286917
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20606