Web Analytics
518-831-8000 sales@utechproducts.com

THYN1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant THYN1, Each

1,757.70

Details:

This gene encodes a protein that is highly conserved among vertebrates and plant species and may be involved in the induction of apoptosis. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeqSequence: AFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMVDVQFVRMMKRFIPLAELKSYHQAHKATGGPL

Additional Information

SKU 10289273
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23340