Web Analytics
518-831-8000 sales@utechproducts.com

TIGD6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TIGD6, Each

1,757.70

Details:

The protein encoded by this gene belongs to the tigger subfamily of the pogo superfamily of DNA-mediated transposons in humans. These proteins are related to DNA transposons found in fungi and nematodes, and more distantly to the Tc1 and mariner transposases. They are also very similar to the major mammalian centromere protein B. The exact function of this gene is not known. [provided by RefSeqSequence: MLGYDNFQASVGWLNRFRDRHGIALKAVCREDSDRLMNGLGIDKINEWHAGEIIKLIADYSPDDIFNADETGVFFQLLPQHTLAAKGDHCRGGKKAKQRL

Additional Information

SKU 10290030
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24346