Web Analytics
518-831-8000 sales@utechproducts.com

TIMM9, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TIMM9, Each

1,757.70

Details:

TIMM9 belongs to a family of evolutionarily conserved proteins that are organized in heterooligomeric complexes in the mitochondrial intermembrane space. These proteins mediate the import and insertion of hydrophobic membrane proteins into the mitochondrial inner membrane.[supplied by OMIMSequence: AAQIPESDQIKQFKEFLGTYNKLTETCFLDCVKDFTTREVKPEETTCSEHCLQKYLKMTQRISMRFQEYHIQQNEALAAKAGLLGQPR

Additional Information

SKU 10292459
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28616