Tjap1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tjap1, Each
$ 1,757.70
|
|
Details:
This gene encodes a tight junction-associated protein. Incorporation of the encoded protein into tight junctions occurs at a late stage of formation of the junctions. The encoded protein localizes to the golgi and may function in vesicle trafficking. Alternatively spliced transcript variants have been described. A related pseudogene exists on the x chromosome. [Provided by refseqsequence: rldcnlavqllkcnkshfrnhkfadlpcelqdmvrkhlhsgqeaaspgpapslapgavvptsviarvlekpeslllnsaqs
Additional Information
| SKU | 10288474 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22407 |
