Tjp2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tjp2, Each

Details:

Tight junction proteins (tjps) belong to a family of membrane-associated guanylate kinase (maguk) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. Tjps bind to the cytoplasmic c termini of junctional transmembrane proteins and link them to the actin cytoskeleton.[Supplied by omimsequence: igvllmksraneeyglrlgsqifvkemtrtglatkdgnlhegdiilkingtvtenmsltdarklieksrgklqlvvlrdsqqtlinipslndsdseiediseiesnrsfspeerrhqysdydyhssseklkerpssredtpsrlsrmg