Web Analytics
518-831-8000 sales@utechproducts.com

Tjp2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tjp2, Each

1,757.70

Details

Tight junction proteins (tjps) belong to a family of membrane-associated guanylate kinase (maguk) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. Tjps bind to the cytoplasmic c termini of junctional transmembrane proteins and link them to the actin cytoskeleton.[Supplied by omimsequence: igvllmksraneeyglrlgsqifvkemtrtglatkdgnlhegdiilkingtvtenmsltdarklieksrgklqlvvlrdsqqtlinipslndsdseiediseiesnrsfspeerrhqysdydyhssseklkerpssredtpsrlsrmg

Additional Information

SKU 10292367
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28487