Web Analytics
518-831-8000 sales@utechproducts.com

TJP2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant TJP2, Each

1,757.70

Details:

Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.[supplied by OMIMSequence: IGVLLMKSRANEEYGLRLGSQIFVKEMTRTGLATKDGNLHEGDIILKINGTVTENMSLTDARKLIEKSRGKLQLVVLRDSQQTLINIPSLNDSDSEIEDISEIESNRSFSPEERRHQYSDYDYHSSSEKLKERPSSREDTPSRLSRMG

Additional Information

SKU 10292367
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28487