Tmlhe, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tmlhe, Each
$ 1,757.70
|
|
Details:
Epsilon-n-trimethyllysine hydroxylase (ec 1.14.11.8) Catalyzes the conversion of epsilon-n-trimethyllysine to beta-hydroxy-n-epsilon-trimethyllysine in the first step of l-carnitine biosynthesis (vaz et al., 2001 [Pubmed 11431483]).[Supplied by omimsequence: aytklaldrhtdttyfqepcgiqvfhclkhegtggrtllvdgfyaaeqvlqkapeefellskvplkheyiedvgechnhmigigpv
Additional Information
| SKU | 10288821 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB22807 |
Loading Cart Data 