Web Analytics
518-831-8000 sales@utechproducts.com

Tmlhe, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Tmlhe, Each

$ 1,757.70

Details

Epsilon-n-trimethyllysine hydroxylase (ec 1.14.11.8) Catalyzes the conversion of epsilon-n-trimethyllysine to beta-hydroxy-n-epsilon-trimethyllysine in the first step of l-carnitine biosynthesis (vaz et al., 2001 [Pubmed 11431483]).[Supplied by omimsequence: aytklaldrhtdttyfqepcgiqvfhclkhegtggrtllvdgfyaaeqvlqkapeefellskvplkheyiedvgechnhmigigpv

Additional Information

SKU 10288821
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22807